SLC25A32 Antikörper (N-Term)

Produktnummer ABIN635067

Dieses Anti-SLC25A32-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC25A32 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für SLC25A32 Antikörper (N-Term) (ABIN635067)

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A32 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC25 A32 antibody was raised against the N terminal of SLC25 32

Aufreinigung: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A32 Blocking Peptide, (ABIN5616221), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Andere Bezeichnung: SLC25A32

Hintergrund: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport