CPT1B Antikörper (Carnitine Palmitoyltransferase 1B (Muscle))

Details for Product anti-CPT1B Antibody No. ABIN635060
Antigen
Reaktivität
Human
104
29
21
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
101
7
1
Klonalität
Polyklonal
Konjugat
Dieser CPT1B Antikörper ist unkonjugiert
9
9
9
7
7
7
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
83
73
37
13
13
3
2
2
1
1
Optionen
Immunogen CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Reinigung Affinity purified
Antigen
Andere Bezeichnung CPT1B (CPT1B Antibody Abstract)
Hintergrund The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.
Molekulargewicht 88 kDa (MW of target protein)
Pathways AMPK Signaling, Monocarboxylic Acid Catabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B) antibody (ABIN635060) CPT1B antibody used at 1 ug/ml to detect target protein.