CPT1B Antikörper

Produktnummer ABIN635060

Produktdetails anti-CPT1B Antikörper

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPT1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPT1B

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Andere Bezeichnung: CPT1B (CPT1B Produkte)

Synonyme: CPT1-M antikoerper, CPT1M antikoerper, CPTI antikoerper, CPTI-M antikoerper, M-CPT1 antikoerper, MCCPT1 antikoerper, MCPT1 antikoerper, CPT-IB antikoerper, M-CPTI antikoerper, CPT1 antikoerper, CPTIB antikoerper, cpt1al antikoerper, zgc:103709 antikoerper, CPT1B antikoerper, MGC147544 antikoerper, Cpt1 antikoerper, Cpt1-m antikoerper, Cpti antikoerper, Cpti-m antikoerper, M-cpti antikoerper, carnitine palmitoyltransferase 1B antikoerper, carnitine palmitoyltransferase 1B (muscle) antikoerper, carnitine palmitoyltransferase 1B L homeolog antikoerper, carnitine palmitoyltransferase 1b, muscle antikoerper, CPT1B antikoerper, Cpt1b antikoerper, cpt1b antikoerper, cpt1b.L antikoerper

Hintergrund: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process