SLC25A32 Antikörper (Middle Region)

Produktnummer ABIN635047

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC25A32 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC25A32 Antikörper (Middle Region) (ABIN635047)

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A32 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC25 A32 antibody was raised against the middle region of SLC25 32

Aufreinigung: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A32 Blocking Peptide, (ABIN5616220), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Andere Bezeichnung: SLC25A32

Hintergrund: SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport