MARCO Antikörper (Macrophage Receptor with Collagenous Structure) (N-Term)

Details for Product anti-MARCO Antibody No. ABIN635028
Antigen
Epitop
N-Term
8
7
2
1
1
1
1
1
1
1
1
Reaktivität
Human
21
12
4
2
1
1
1
Wirt
Kaninchen
19
6
4
1
Klonalität
Polyklonal
Konjugat
Dieser MARCO Antikörper ist unkonjugiert
3
2
1
1
1
1
Applikation
Western Blotting (WB)
24
15
13
10
4
4
3
2
2
1
Optionen
Immunogen MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
Spezifität MARCO antibody was raised against the N terminal of MARCO
Reinigung Affinity purified
Antigen
Andere Bezeichnung MARCO (MARCO Antibody Abstract)
Hintergrund The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system.
Molekulargewicht 53 kDa (MW of target protein)
Pathways Activation of Innate immune Response
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MARCO Blocking Peptide, catalog no. 33R-7477, is also available for use as a blocking control in assays to test for specificity of this MARCO antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARCO antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Macrophage Receptor with Collagenous Structure (MARCO) (N-Term) antibody (ABIN635028) MARCO antibody used at 1 ug/ml to detect target protein.