SPPL2B Antikörper (N-Term)
-
- Target Alle SPPL2B Antikörper anzeigen
- SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPPL2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SPPL2 B antibody was raised against the N terminal of SPPL2
- Aufreinigung
- Affinity purified
- Immunogen
- SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
- Top Product
- Discover our top product SPPL2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPPL2B Blocking Peptide, catalog no. 33R-9434, is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPPL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))
- Andere Bezeichnung
- SPPL2B (SPPL2B Produkte)
- Synonyme
- SPPL2B antikoerper, wu:fc16e01 antikoerper, wu:fc85d12 antikoerper, zgc:136525 antikoerper, MGC147524 antikoerper, IMP-4 antikoerper, IMP4 antikoerper, PSH4 antikoerper, PSL1 antikoerper, 3110056O03Rik antikoerper, AW550292 antikoerper, RGD1308556 antikoerper, signal peptide peptidase-like 2 antikoerper, signal peptide peptidase like 2B antikoerper, signal peptide peptidase like 2B S homeolog antikoerper, signal peptide peptidase-like 2B antikoerper, sppl2 antikoerper, sppl2b antikoerper, sppl2b.S antikoerper, SPPL2B antikoerper, Sppl2b antikoerper
- Hintergrund
- SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
- Molekulargewicht
- 56 kDa (MW of target protein)
-