SPPL2B Antikörper (N-Term)

Produktnummer ABIN634985

Der Kaninchen Polyklonal Anti-SPPL2B-Antikörper wurde für WB und IHC validiert. Er ist geeignet, SPPL2B in Proben von Human zu detektieren.

Kurzübersicht für SPPL2B Antikörper (N-Term) (ABIN634985)

Target: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPPL2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SPPL2B Antikörper

Bindungsspezifität: N-Term

Spezifität: SPPL2 B antibody was raised against the N terminal of SPPL2

Aufreinigung: Affinity purified

Immunogen: SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPPL2B Blocking Peptide, (ABIN5616378), is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPPL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPPL2B

Target: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Andere Bezeichnung: SPPL2B

Hintergrund: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Molekulargewicht: 56 kDa (MW of target protein)