PARL Antikörper (N-Term)

Produktnummer ABIN634971

Dieses Anti-PARL-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PARL in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für PARL Antikörper (N-Term) (ABIN634971)

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PARL Antikörper

Bindungsspezifität: N-Term

Spezifität: PARL antibody was raised against the N terminal of PARL

Aufreinigung: Affinity purified

Immunogen: PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARL Blocking Peptide, (ABIN5615220), is also available for use as a blocking control in assays to test for specificity of this PARL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARL

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Andere Bezeichnung: PARL

Hintergrund: PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Autophagie