Der1-Like Domain Family, Member 3 (DERL3) (C-Term) Antikörper

Details zu Produkt Nr. ABIN634939
Antigen
Epitop
C-Term
11
2
2
1
Reaktivität
Human, Maus, Ratte (Rattus)
19
5
4
4
4
4
4
4
3
2
2
2
1
1
1
Wirt
Kaninchen
19
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
18
10
8
4
2
1
Optionen
Immunogen DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP
Spezifität DERL3 antibody was raised against the C terminal of DERL3
Reinigung Affinity purified
Antigen
Andere Bezeichnung DERL3 (DERL3 Antibody Abstract)
Hintergrund DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molekulargewicht 27 kDa (MW of target protein)
Pathways ER-Nucleus Signaling
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Der1-Like Domain Family, Member 3 (DERL3) (C-Term) antibody (ABIN634939) DERL3 antibody used at 1 ug/ml to detect target protein.