Derlin-3 Antikörper (C-Term)

Produktnummer ABIN634939

Produktdetails anti-Derlin-3 Antikörper

Target: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Derlin-3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DERL3 antibody was raised against the C terminal of DERL3

Aufreinigung: Affinity purified

Immunogen: DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Derlin-3

Target: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Andere Bezeichnung: DERL3 (DERL3 Produkte)

Synonyme: 1810006I20Rik antikoerper, 1810063P04Rik antikoerper, IZP6 antikoerper, derlin-3 antikoerper, zgc:63991 antikoerper, C22orf14 antikoerper, LLN2 antikoerper, derlin 3 antikoerper, Der1-like domain family, member 3 antikoerper, DERL3 antikoerper, Derl3 antikoerper, derl3 antikoerper

Hintergrund: DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling