Metaxin 1 Antikörper (C-Term)

Produktnummer ABIN634920

Dieses Anti-Metaxin 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Metaxin 1 in WB. Geeignet für Human und Maus.

Kurzübersicht für Metaxin 1 Antikörper (C-Term) (ABIN634920)

Target: Metaxin 1 (MTX1)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Metaxin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Metaxin 1 Antikörper

Bindungsspezifität: C-Term

Spezifität: Metaxin 1 antibody was raised against the C terminal of MTX1

Aufreinigung: Affinity purified

Immunogen: Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Metaxin 1 Blocking Peptide, (ABIN937134), is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Metaxin 1

Target: Metaxin 1 (MTX1)

Andere Bezeichnung: Metaxin 1

Hintergrund: MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport