DISP1 Antikörper

Produktnummer ABIN634914

Dieses Anti-DISP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DISP1 in WB. Geeignet für Human.

Kurzübersicht für DISP1 Antikörper (ABIN634914)

Target: DISP1 (Dispatched Homolog 1 (DISP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DISP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DISP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DISP1

Target: DISP1 (Dispatched Homolog 1 (DISP1))

Andere Bezeichnung: DISP1

Hintergrund: DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.

Molekulargewicht: 171 kDa (MW of target protein)

Pathways: Hedgehog Signalweg