LFNG Antikörper (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase) (N-Term)

Details for Product anti-LFNG Antibody No. ABIN634905
Antigen
Epitop
N-Term
14
12
10
9
8
4
2
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
64
13
11
2
1
1
1
1
1
1
Wirt
Kaninchen
49
15
Klonalität
Polyklonal
Konjugat
Dieser LFNG Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
54
40
26
22
5
4
1
1
Optionen
Immunogen LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK
Spezifität LFNG antibody was raised against the N terminal of LFNG
Reinigung Affinity purified
Antigen
Andere Bezeichnung LFNG (LFNG Antibody Abstract)
Hintergrund LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.
Molekulargewicht 39 kDa (MW of target protein)
Pathways Notch Signalweg
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG) (N-Term) antibody (ABIN634905) LFNG antibody used at 1 ug/ml to detect target protein.