SLC43A1 Antikörper (Middle Region)

Produktnummer ABIN634904

Produktdetails anti-SLC43A1 Antikörper

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC43A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC43 A1 antibody was raised against the middle region of SLC43 1

Aufreinigung: Affinity purified

Immunogen: SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC43A1 Blocking Peptide, catalog no. 33R-1608, is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC43A1

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Andere Bezeichnung: SLC43A1 (SLC43A1 Produkte)

Synonyme: 2610016F07Rik antikoerper, AA986141 antikoerper, Lat3 antikoerper, PB39 antikoerper, Pov1 antikoerper, R00504 antikoerper, LAT3 antikoerper, POV1 antikoerper, fi47a12 antikoerper, lat3a antikoerper, slc43a1 antikoerper, wu:fi47a12 antikoerper, zgc:55850 antikoerper, wu:fa01a01 antikoerper, zgc:158383 antikoerper, solute carrier family 43, member 1 antikoerper, solute carrier family 43 member 1 antikoerper, solute carrier family 43 (amino acid system L transporter), member 1a antikoerper, solute carrier family 43 (amino acid system L transporter), member 1b antikoerper, solute carrier family 43 member 1 L homeolog antikoerper, Slc43a1 antikoerper, SLC43A1 antikoerper, slc43a1a antikoerper, slc43a1b antikoerper, slc43a1.L antikoerper

Hintergrund: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Molekulargewicht: 61 kDa (MW of target protein)