SLC43A1 Antikörper (Middle Region)

Produktnummer ABIN634904

Der Kaninchen-Polyklonal Anti-SLC43A1-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von SLC43A1 in Proben aus Human. }

Kurzübersicht für SLC43A1 Antikörper (Middle Region) (ABIN634904)

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC43A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC43A1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC43 A1 antibody was raised against the middle region of SLC43 1

Aufreinigung: Affinity purified

Immunogen: SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC43A1 Blocking Peptide, (ABIN936994), is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC43A1

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Andere Bezeichnung: SLC43A1

Hintergrund: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Molekulargewicht: 61 kDa (MW of target protein)