BAT5 Antikörper (Abhydrolase Domain Containing 16A) (Middle Region)

Details for Product anti-ABHD16A Antibody No. ABIN634883
Antigen
Epitop
Middle Region
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
24
21
20
4
4
4
3
2
2
1
1
1
Wirt
Kaninchen
23
1
Klonalität
Polyklonal
Konjugat
Dieser BAT5 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
12
4
3
1
Optionen
Immunogen BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL
Spezifität BAT5 antibody was raised against the middle region of BAT5
Reinigung Affinity purified
Antigen
Andere Bezeichnung BAT5 (ABHD16A Antibody Abstract)
Hintergrund A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.
Molekulargewicht 63 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

BAT5 Blocking Peptide, catalog no. 33R-7812, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Abhydrolase Domain Containing 16A (ABHD16A) (Middle Region) antibody (ABIN634883) BAT5 antibody used at 1 ug/ml to detect target protein.