BAT5 Antikörper (N-Term)

Produktnummer ABIN635476

Produktdetails anti-BAT5 Antikörper

Target: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BAT5 antibody was raised against the N terminal of BAT5

Aufreinigung: Affinity purified

Immunogen: BAT5 antibody was raised using the N terminal of BAT5 corresponding to a region with amino acids VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BAT5 Blocking Peptide, catalog no. 33R-9837, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAT5

Target: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Andere Bezeichnung: BAT5 (ABHD16A Produkte)

Synonyme: BAT5 antikoerper, D6S82E antikoerper, NG26 antikoerper, PP199 antikoerper, AI326074 antikoerper, Bat-5 antikoerper, Bat5 antikoerper, D17H6S82E antikoerper, bat5 antikoerper, bat5l antikoerper, wu:fb55e01 antikoerper, bat5-b antikoerper, ng26 antikoerper, pp199 antikoerper, abhydrolase domain containing 16A antikoerper, abhydrolase domain containing 16A L homeolog antikoerper, ABHD16A antikoerper, Abhd16a antikoerper, abhd16a antikoerper, abhd16a.L antikoerper

Hintergrund: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.

Molekulargewicht: 63 kDa (MW of target protein)