DNASE1 Antikörper (N-Term)

Produktnummer ABIN634872

Produktdetails anti-DNASE1 Antikörper

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNASE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DNASE1 antibody was raised against the N terminal of DNASE1

Aufreinigung: Affinity purified

Immunogen: DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNASE1 Blocking Peptide, catalog no. 33R-3371, is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNASE1

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Andere Bezeichnung: DNASE1 (DNASE1 Produkte)

Synonyme: LOC397802 antikoerper, DNL1 antikoerper, DRNI antikoerper, AI788650 antikoerper, DNaseI antikoerper, Dnl1 antikoerper, dnase1-A antikoerper, zgc:92440 antikoerper, DNase I antikoerper, deoxyribonuclease 1 antikoerper, deoxyribonuclease I antikoerper, deoxyribonuclease I L homeolog antikoerper, Deoxyribonuclease I antikoerper, endA antikoerper, LOC397802 antikoerper, DNASE1 antikoerper, Dnase1 antikoerper, dnase1.L antikoerper, dnase1 antikoerper, CpipJ_CPIJ011184 antikoerper, CpipJ_CPIJ011185 antikoerper, CpipJ_CPIJ011186 antikoerper, CpipJ_CPIJ011187 antikoerper, CpipJ_CPIJ011190 antikoerper, CpipJ_CPIJ017803 antikoerper, Desal_1409 antikoerper, MPET_RS05255 antikoerper, METEV_RS02275 antikoerper, Plabr_0631 antikoerper

Hintergrund: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

Molekulargewicht: 29 kDa (MW of target protein)