DNASE1 Antikörper (N-Term)

Produktnummer ABIN634872

Dieses Anti-DNASE1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DNASE1 in WB. Geeignet für Human.

Kurzübersicht für DNASE1 Antikörper (N-Term) (ABIN634872)

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNASE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNASE1 Antikörper

Bindungsspezifität: N-Term

Spezifität: DNASE1 antibody was raised against the N terminal of DNASE1

Aufreinigung: Affinity purified

Immunogen: DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNASE1 Blocking Peptide, (ABIN938757), is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNASE1

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Andere Bezeichnung: DNASE1

Hintergrund: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

Molekulargewicht: 29 kDa (MW of target protein)