ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4) Antikörper

Details zu Produkt Nr. ABIN634864
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
50
31
18
5
4
4
3
3
2
1
1
1
1
Wirt
Kaninchen
44
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
45
28
20
6
3
1
1
Optionen
Immunogen ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCD4 (ABCD4 Antibody Abstract)
Hintergrund ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown.
Molekulargewicht 68 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCD4 Blocking Peptide, catalog no. 33R-10287, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4) antibody (ABIN634864) ABCD4 antibody used at 1 ug/ml to detect target protein.