Myoferlin Antikörper

Produktnummer ABIN634863

Dieses Anti-Myoferlin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Myoferlin in WB. Geeignet für Human.

Kurzübersicht für Myoferlin Antikörper (ABIN634863)

Target: Myoferlin (MYOF)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Myoferlin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Myoferlin Antikörper

Aufreinigung: Affinity purified

Immunogen: FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FER1L3 Blocking Peptide, (ABIN5613569), is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Myoferlin

Target: Myoferlin (MYOF)

Andere Bezeichnung: FER1L3

Hintergrund: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.

Molekulargewicht: 235 kDa (MW of target protein)