PDE3A Antikörper (phosphodiesterase 3A, cGMP-Inhibited) (N-Term)

Details for Product anti-PDE3A Antibody No. ABIN634852
Antigen
Epitop
N-Term
15
9
5
4
3
3
2
2
1
1
1
1
1
Reaktivität
Human
63
31
27
10
7
4
4
3
3
2
1
Wirt
Kaninchen
59
6
3
Klonalität
Polyklonal
Konjugat
Dieser PDE3A Antikörper ist unkonjugiert
4
3
1
1
1
1
1
1
Applikation
Western Blotting (WB)
35
26
22
17
16
4
4
3
2
1
1
Optionen
Immunogen PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
Spezifität PDE3 A antibody was raised against the N terminal of PDE3
Reinigung Affinity purified
Antigen
Andere Bezeichnung PDE3A (PDE3A Antibody Abstract)
Hintergrund PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
Molekulargewicht 125 kDa (MW of target protein)
Pathways cAMP Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (N-Term) antibody (ABIN634852) PDE3A antibody used at 1 ug/ml to detect target protein.