PDE3A Antikörper (N-Term)

Produktnummer ABIN634852

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PDE3A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PDE3A Antikörper (N-Term) (ABIN634852)

Target: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDE3A Antikörper

Bindungsspezifität: N-Term

Spezifität: PDE3 A antibody was raised against the N terminal of PDE3

Aufreinigung: Affinity purified

Immunogen: PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE3A

Target: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Andere Bezeichnung: PDE3A

Hintergrund: PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).

Molekulargewicht: 125 kDa (MW of target protein)

Pathways: cAMP Metabolic Process