Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) Antikörper

Details zu Produkt Nr. ABIN634849
Antigen
Reaktivität
Human
48
20
20
4
4
3
3
3
3
1
Wirt
Kaninchen
41
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
30
23
19
17
13
5
Optionen
Immunogen PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD
Reinigung Affinity purified
Antigen
Andere Bezeichnung PARP16
Hintergrund Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.
Molekulargewicht 36 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PARP16 Blocking Peptide, catalog no. 33R-4620, is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) antibody (ABIN634849) PARP16 antibody used at 0.5 ug/ml to detect target protein.