PARP16 Antikörper

Produktnummer ABIN634849

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch PARP16 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PARP16 Antikörper (ABIN634849)

Target: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARP16 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP16 Blocking Peptide, (ABIN940006), is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP16

Target: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Andere Bezeichnung: PARP16

Hintergrund: Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.

Molekulargewicht: 36 kDa (MW of target protein)