FMO4 Antikörper (Flavin Containing Monooxygenase 4) (N-Term)

Details for Product anti-FMO4 Antibody No. ABIN634825
Antigen
Epitop
N-Term
4
4
4
3
2
2
1
1
Reaktivität
Human
21
11
10
4
4
4
4
3
1
1
1
Wirt
Kaninchen
17
4
Klonalität
Polyklonal
Konjugat
Dieser FMO4 Antikörper ist unkonjugiert
2
2
1
Applikation
Western Blotting (WB)
17
5
4
3
1
Optionen
Immunogen FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG
Spezifität FMO4 antibody was raised against the N terminal of FMO4
Reinigung Affinity purified
Antigen
Andere Bezeichnung FMO4 (FMO4 Antibody Abstract)
Hintergrund FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.
Molekulargewicht 63 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Flavin Containing Monooxygenase 4 (FMO4) (N-Term) antibody (ABIN634825) FMO4 antibody used at 1 ug/ml to detect target protein.