ABCC9 Antikörper
-
- Target Alle ABCC9 Antikörper anzeigen
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCC9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
- Top Product
- Discover our top product ABCC9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Andere Bezeichnung
- ABCC9 (ABCC9 Produkte)
- Synonyme
- SUR2B antikoerper, DDBDRAFT_0215814 antikoerper, DDBDRAFT_0216237 antikoerper, DDB_0215814 antikoerper, DDB_0216237 antikoerper, si:dkey-183c2.3 antikoerper, sur2 antikoerper, ABC37 antikoerper, ATFB12 antikoerper, CANTU antikoerper, CMD1O antikoerper, SUR2 antikoerper, SUR2A antikoerper, AI414027 antikoerper, AI449286 antikoerper, Sur2 antikoerper, ABCC9 antikoerper, ATP binding cassette subfamily C member 9 antikoerper, ATP-binding cassette sub-family C member 8 antikoerper, ABC transporter C family protein antikoerper, ATP-binding cassette sub-family C member 9 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 9 antikoerper, ABCC9 antikoerper, LOC581821 antikoerper, abcC9 antikoerper, LOC100470981 antikoerper, abcc9 antikoerper, Abcc9 antikoerper
- Hintergrund
- ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.
- Molekulargewicht
- 174 kDa (MW of target protein)
-