ABCC9 Antikörper (AA 1505-1546)

Produktnummer ABIN1686640

Dieser Maus Monoklonal Antikörper detektiert spezifisch ABCC9 in WB, IHC, ICC und IF. Es zeigt Reaktivität gegenüber Proben von Maus.

Kurzübersicht für ABCC9 Antikörper (AA 1505-1546) (ABIN1686640)

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reaktivität: Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ABCC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)

Klon: S319A-14

Produktdetails anti-ABCC9 Antikörper

Bindungsspezifität: AA 1505-1546

Spezifität: Detects ~120 kDa. Does not cross-react with SUR2B.

Kreuzreaktivität: Human, Maus, Ratte

Aufreinigung: Protein G Purified

Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise:

• WB (1:1000)
• optimal dilutions for assays should be determined by the user.

Kommentare:

1 μg/ml of ABIN1686640 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu ABCC9

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Andere Bezeichnung: SUR2A

Hintergrund: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Gen-ID: 20928

NCBI Accession: NP_001038185

UniProt: P70170