Neuregulin 1 Antikörper (Middle Region)

Produktnummer ABIN634812

Der Kaninchen Polyklonal anti-Neuregulin 1 Antikörper (ABIN634812) detektiert spezifisch Neuregulin 1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Neuregulin 1 Antikörper (Middle Region) (ABIN634812)

Target: Neuregulin 1 (NRG1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuregulin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Neuregulin 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NRG1 antibody was raised against the middle region of NRG1

Aufreinigung: Affinity purified

Immunogen: NRG1 antibody was raised using the middle region of NRG1 corresponding to a region with amino acids SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRG1 Blocking Peptide, (ABIN5615062), is also available for use as a blocking control in assays to test for specificity of this NRG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuregulin 1

Target: Neuregulin 1 (NRG1)

Andere Bezeichnung: NRG1

Hintergrund: Neuregulin 1 (NRG1) was originally identified as a 44 kDa glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Muscle Cell Differentiation