Neuregulin 3 Antikörper (Middle Region)

Produktnummer ABIN634810

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Neuregulin 3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Neuregulin 3 Antikörper (Middle Region) (ABIN634810)

Target: Neuregulin 3 (NRG3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuregulin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Neuregulin 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NRG3 antibody was raised against the middle region of NRG3

Aufreinigung: Affinity purified

Immunogen: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRG3 Blocking Peptide, (ABIN5615063), is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuregulin 3

Target: Neuregulin 3 (NRG3)

Andere Bezeichnung: NRG3

Hintergrund: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: RTK Signalweg