IL5 Antikörper (Interleukin 5)

Details for Product anti-IL5 Antibody No. ABIN634806
Antigen
Reaktivität
Human
133
83
37
7
3
3
2
2
2
2
2
2
2
1
1
Wirt
Kaninchen
109
60
23
2
Klonalität
Polyklonal
Konjugat
Dieser IL5 Antikörper ist unkonjugiert
35
7
4
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
124
118
31
27
26
21
19
16
13
11
9
7
5
5
5
3
3
3
2
2
1
Optionen
Immunogen IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
Reinigung Affinity purified
Antigen
Andere Bezeichnung IL5 (IL5 Antibody Abstract)
Hintergrund IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.
Molekulargewicht 13 kDa (MW of target protein)
Pathways JAK-STAT Signalweg, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

IL5 Blocking Peptide, catalog no. 33R-4928, is also available for use as a blocking control in assays to test for specificity of this IL5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Interleukin 5 (IL5) antibody (ABIN634806) IL5 antibody used at 1 ug/ml to detect target protein.