IL-5 Antikörper

Produktnummer ABIN634806

Dieses Anti-IL-5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IL-5 in WB. Geeignet für Human.

Kurzübersicht für IL-5 Antikörper (ABIN634806)

Target: IL-5 (IL5) (Interleukin 5 (IL5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-5 Antikörper

Aufreinigung: Affinity purified

Immunogen: IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL5 Blocking Peptide, (ABIN940314), is also available for use as a blocking control in assays to test for specificity of this IL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-5

Target: IL-5 (IL5) (Interleukin 5 (IL5))

Andere Bezeichnung: IL5

Hintergrund: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour