IL-4 Antikörper (Middle Region)

Produktnummer ABIN634805

Der Kaninchen Polyklonal anti-IL-4 Antikörper wird verwendet zum Nachweis von IL-4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für IL-4 Antikörper (Middle Region) (ABIN634805)

Target: IL-4 (IL4) (Interleukin 4 (IL4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IL4 antibody was raised against the middle region of IL4

Aufreinigung: Affinity purified

Immunogen: IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL4 Blocking Peptide, (ABIN940448), is also available for use as a blocking control in assays to test for specificity of this IL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-4

Target: IL-4 (IL4) (Interleukin 4 (IL4))

Andere Bezeichnung: IL4

Hintergrund: IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation