Cholecystokinin Antikörper (Middle Region)

Produktnummer ABIN634802

Produktdetails anti-Cholecystokinin Antikörper

Target: Cholecystokinin (CCK)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cholecystokinin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCK antibody was raised against the middle region of CCK

Aufreinigung: Affinity purified

Immunogen: CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCK Blocking Peptide, catalog no. 33R-4121, is also available for use as a blocking control in assays to test for specificity of this CCK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cholecystokinin

Target: Cholecystokinin (CCK)

Andere Bezeichnung: CCK (CCK Produkte)

Synonyme: CCK antikoerper, CCK-CH antikoerper, cck-a antikoerper, cck-b antikoerper, cholecystokinin antikoerper, cholecystokinin L homeolog antikoerper, CCK antikoerper, Cck antikoerper, cck antikoerper, cck.L antikoerper

Hintergrund: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades, Feeding Behaviour