LEFTY2 Antikörper (N-Term)
-
- Target Alle LEFTY2 Antikörper anzeigen
- LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LEFTY2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LEFTY2 antibody was raised against the N terminal of LEFTY2
- Aufreinigung
- Affinity purified
- Immunogen
- LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
- Top Product
- Discover our top product LEFTY2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))
- Andere Bezeichnung
- LEFTY2 (LEFTY2 Produkte)
- Synonyme
- EBAF antikoerper, LEFTA antikoerper, LEFTYA antikoerper, TGFB4 antikoerper, AI450052 antikoerper, Ebaf antikoerper, Leftb antikoerper, Stra3 antikoerper, Tgfb4 antikoerper, lefty antikoerper, lefty-1 antikoerper, atv2 antikoerper, cb720 antikoerper, fe38b03 antikoerper, wu:fe38b03 antikoerper, 6030463A22Rik antikoerper, AV214969 antikoerper, Lefta antikoerper, Ebaf2 antikoerper, left-right determination factor 2 antikoerper, left right determination factor 1 antikoerper, lefty2 antikoerper, Left-right determination factor 2 antikoerper, left-right determination factor 2-like antikoerper, LEFTY2 antikoerper, Lefty1 antikoerper, lft2 antikoerper, Lefty2 antikoerper, LOC699676 antikoerper, LOC100232580 antikoerper
- Hintergrund
- LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.
- Molekulargewicht
- 40 kDa (MW of target protein)
-