AMH Antikörper (Middle Region)

Produktnummer ABIN634797

Dieser Anti-AMH Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von AMH in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für AMH Antikörper (Middle Region) (ABIN634797)

Target: AMH (Anti-Mullerian Hormone (AMH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AMH Antikörper

Bindungsspezifität: Middle Region

Spezifität: AMH antibody was raised against the middle region of AMH

Aufreinigung: Affinity purified

Immunogen: AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMH Blocking Peptide, (ABIN5612045), is also available for use as a blocking control in assays to test for specificity of this AMH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMH

Target: AMH (Anti-Mullerian Hormone (AMH))

Andere Bezeichnung: AMH

Hintergrund: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion