Stanniocalcin 1 Antikörper (N-Term)

Produktnummer ABIN634788

Produktdetails anti-Stanniocalcin 1 Antikörper

Target: Stanniocalcin 1 (STC1)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Stanniocalcin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STC1 antibody was raised against the N terminal of STC1

Aufreinigung: Affinity purified

Immunogen: STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Stanniocalcin 1

Target: Stanniocalcin 1 (STC1)

Andere Bezeichnung: STC1 (STC1 Produkte)

Synonyme: STC antikoerper, Stc antikoerper, stc1 antikoerper, MGC82280 antikoerper, STC1 antikoerper, zgc:153307 antikoerper, LOC777959 antikoerper, stanniocalcin 1 antikoerper, stanniocalcin 1 L homeolog antikoerper, stanniocalcin 1 S homeolog antikoerper, STC1 antikoerper, Stc1 antikoerper, stc1.L antikoerper, stc1.S antikoerper, stc1 antikoerper, LOC777959 antikoerper

Hintergrund: STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Hormone Activity