Norrie Disease (Pseudoglioma) Antikörper

Produktnummer ABIN634783

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Norrie Disease (Pseudoglioma) in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für Norrie Disease (Pseudoglioma) Antikörper (ABIN634783)

Target: Norrie Disease (Pseudoglioma) (NDP)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Norrie Disease (Pseudoglioma) Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Norrie Disease (Pseudoglioma) Antikörper

Aufreinigung: Affinity purified

Immunogen: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDP Blocking Peptide, (ABIN937500), is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Norrie Disease (Pseudoglioma)

Target: Norrie Disease (Pseudoglioma) (NDP)

Andere Bezeichnung: NDP

Hintergrund: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound