Norrie Disease (Pseudoglioma) Antikörper

Produktnummer ABIN634783

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Norrie Disease (Pseudoglioma) in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Norrie Disease (Pseudoglioma) Antikörper (ABIN634783)

Target: Norrie Disease (Pseudoglioma) (NDP)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Norrie Disease (Pseudoglioma) Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Norrie Disease (Pseudoglioma) Antikörper

Aufreinigung: Affinity purified

Immunogen: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDP Blocking Peptide, (ABIN937500), is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Norrie Disease (Pseudoglioma)

Target: Norrie Disease (Pseudoglioma) (NDP)

Andere Bezeichnung: NDP

Hintergrund: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound