BDNF Antikörper (Middle Region)

Produktnummer ABIN634782

Dieses Anti-BDNF-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BDNF in WB. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für BDNF Antikörper (Middle Region) (ABIN634782)

Target: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BDNF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BDNF Antikörper

Bindungsspezifität: Middle Region

Spezifität: BDNF antibody was raised against the middle region of BDNF

Aufreinigung: Affinity purified

Immunogen: BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BDNF Blocking Peptide, (ABIN938199), is also available for use as a blocking control in assays to test for specificity of this BDNF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BDNF

Target: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Andere Bezeichnung: BDNF

Hintergrund: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: RTK Signalweg, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity