FGF21 Antikörper (N-Term)

Produktnummer ABIN634771

Produktdetails anti-FGF21 Antikörper

Target: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGF21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FGF21 antibody was raised against the N terminal of FGF21

Aufreinigung: Affinity purified

Immunogen: FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGF21 Blocking Peptide, catalog no. 33R-2157, is also available for use as a blocking control in assays to test for specificity of this FGF21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGF21

Target: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Andere Bezeichnung: FGF21 (FGF21 Produkte)

Synonyme: FGF21 antikoerper, fibroblast growth factor 21 antikoerper, FGF21 antikoerper, fgf21 antikoerper, Fgf21 antikoerper

Hintergrund: FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: RTK Signalweg