CD5 Antikörper (N-Term)
-
- Target Alle CD5 Antikörper anzeigen
- CD5
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CD5 antibody was raised against the N terminal of CD5
- Aufreinigung
- Affinity purified
- Immunogen
- CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
- Top Product
- Discover our top product CD5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD5
- Andere Bezeichnung
- CD5 (CD5 Produkte)
- Synonyme
- CD5 antikoerper, Ly-1 antikoerper, Ly-12 antikoerper, Ly-A antikoerper, Lyt-1 antikoerper, LEU1 antikoerper, T1 antikoerper, CD5 molecule antikoerper, CD5 antigen antikoerper, CD5 molecule like antikoerper, Cd5 molecule antikoerper, CD5 antikoerper, Cd5 antikoerper, CD5L antikoerper
- Hintergrund
- CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
- Molekulargewicht
- 54 kDa (MW of target protein)
-