CD5 Antikörper (CD5 Molecule) (N-Term)

Details for Product anti-CD5 Antibody No. ABIN634761
Antigen
Epitop
N-Term
15
15
14
14
14
10
10
7
7
7
6
6
6
4
4
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
650
244
136
53
48
39
35
33
32
27
25
24
21
5
2
2
1
1
Wirt
Kaninchen
662
168
144
Klonalität
Polyklonal
Konjugat
Dieser CD5 Antikörper ist unkonjugiert
134
115
77
63
14
14
10
9
9
7
5
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
3
3
3
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
734
229
205
159
146
112
77
68
54
24
14
14
14
13
12
11
4
3
2
2
1
1
1
Optionen
Immunogen CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Spezifität CD5 antibody was raised against the N terminal of CD5
Reinigung Affinity purified
Antigen
Andere Bezeichnung CD5 (CD5 Antibody Abstract)
Hintergrund CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
Molekulargewicht 54 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-CD5 Molecule (CD5) (N-Term) antibody (ABIN634761) CD5 antibody used at 1 ug/ml to detect target protein.