CD5 Antikörper (N-Term)

Produktnummer ABIN634761

Dieses Anti-CD5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CD5 in WB. Geeignet für Human.

Kurzübersicht für CD5 Antikörper (N-Term) (ABIN634761)

Target: CD5

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CD5 Antikörper

Bindungsspezifität: N-Term

Spezifität: CD5 antibody was raised against the N terminal of CD5

Aufreinigung: Affinity purified

Immunogen: CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CD5 Blocking Peptide, (ABIN5612760), is also available for use as a blocking control in assays to test for specificity of this CD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CD5

Target: CD5

Andere Bezeichnung: CD5

Hintergrund: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Molekulargewicht: 54 kDa (MW of target protein)