Mesothelin Antikörper (Middle Region)

Produktnummer ABIN634759

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Mesothelin in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Mesothelin Antikörper (Middle Region) (ABIN634759)

Target: Mesothelin (MSLN)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Mesothelin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Mesothelin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Mesothelin antibody was raised against the middle region of MSLN

Aufreinigung: Affinity purified

Immunogen: Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Mesothelin Blocking Peptide, catalog no. 33R-5073, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Mesothelin

Target: Mesothelin (MSLN)

Andere Bezeichnung: Mesothelin

Hintergrund: An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium and mesothelioma.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process