GJD2 Antikörper (Middle Region)

Produktnummer ABIN634734

Der Kaninchen Polyklonal anti-GJD2 Antikörper (ABIN634734) detektiert spezifisch GJD2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für GJD2 Antikörper (Middle Region) (ABIN634734)

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GJD2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GJD2 antibody was raised against the middle region of GJD2

Aufreinigung: Affinity purified

Immunogen: GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJD2 Blocking Peptide, (ABIN937950), is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJD2

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Andere Bezeichnung: GJD2

Hintergrund: GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

Molekulargewicht: 36 kDa (MW of target protein)