Claudin 11 Antikörper

Produktnummer ABIN634717

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Claudin 11 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für Claudin 11 Antikörper (ABIN634717)

Target: Claudin 11 (CLDN11)

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Claudin 11 Antikörper

Aufreinigung: Affinity purified

Immunogen: Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 11 Blocking Peptide, (ABIN5612905), is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 11

Target: Claudin 11 (CLDN11)

Andere Bezeichnung: Claudin 11

Hintergrund: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Hepatitis C