CSGALNACT1 Antikörper (C-Term)

Produktnummer ABIN634698

Dieses Anti-CSGALNACT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CSGALNACT1 in WB. Geeignet für Human und Maus.

Kurzübersicht für CSGALNACT1 Antikörper (C-Term) (ABIN634698)

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSGALNACT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSGALNACT1 Antikörper

Bindungsspezifität: C-Term

Spezifität: CHGN antibody was raised against the C terminal Of Chgn

Aufreinigung: Affinity purified

Immunogen: CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHGN Blocking Peptide, (ABIN937296), is also available for use as a blocking control in assays to test for specificity of this CHGN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSGALNACT1

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Andere Bezeichnung: CHGN

Hintergrund: ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process