CSGALNACT1 Antikörper (N-Term)

Produktnummer ABIN634697

Produktdetails anti-CSGALNACT1 Antikörper

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSGALNACT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1

Aufreinigung: Affinity purified

Immunogen: CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSGALNACT1 Blocking Peptide, catalog no. 33R-4236, is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGALNACT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSGALNACT1

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Andere Bezeichnung: CSGALNACT1 (CSGALNACT1 Produkte)

Synonyme: CSGalNAcT-1 antikoerper, ChGn antikoerper, beta4GalNAcT antikoerper, CHGN antikoerper, 4732435N03Rik antikoerper, Chgn antikoerper, RGD1307618 antikoerper, chondroitin sulfate N-acetylgalactosaminyltransferase 1 antikoerper, CSGALNACT1 antikoerper, csgalnact1 antikoerper, Csgalnact1 antikoerper, LOC100517735 antikoerper

Hintergrund: CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process