PCDH12 Antikörper (Middle Region)

Produktnummer ABIN634683

Produktdetails anti-PCDH12 Antikörper

Target: PCDH12 (Protocadherin 12 (PCDH12))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDH12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDH12 antibody was raised against the middle region of PCDH12

Aufreinigung: Affinity purified

Immunogen: PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDH12 Blocking Peptide, catalog no. 33R-8846, is also available for use as a blocking control in assays to test for specificity of this PCDH12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDH12

Target: PCDH12 (Protocadherin 12 (PCDH12))

Andere Bezeichnung: PCDH12 (PCDH12 Produkte)

Synonyme: PCDH12 antikoerper, VE-cadherin-2 antikoerper, VECAD2 antikoerper, Pcdh14 antikoerper, VE-cad-2 antikoerper, protocadherin 12 antikoerper, PCDH12 antikoerper, Pcdh12 antikoerper

Hintergrund: PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Molekulargewicht: 126 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process