Desmoglein 2 Antikörper (N-Term)

Produktnummer ABIN634678

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Desmoglein 2 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Desmoglein 2 Antikörper (N-Term) (ABIN634678)

Target: Desmoglein 2 (DSG2)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Desmoglein 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Desmoglein 2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Desmoglein 2 antibody was raised against the N terminal of DSG2

Aufreinigung: Affinity purified

Immunogen: Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Desmoglein 2 Blocking Peptide, (ABIN939816), is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Desmoglein 2

Target: Desmoglein 2 (DSG2)

Andere Bezeichnung: Desmoglein 2

Hintergrund: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.

Molekulargewicht: 114 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization