MICA Antikörper (N-Term)

Produktnummer ABIN634664

Der Kaninchen Polyklonal anti-MICA Antikörper wird verwendet zum Nachweis von MICA in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für MICA Antikörper (N-Term) (ABIN634664)

Target: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MICA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MICA Antikörper

Bindungsspezifität: N-Term

Spezifität: MICA antibody was raised against the N terminal of MICA

Aufreinigung: Affinity purified

Immunogen: MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MICA Blocking Peptide, (ABIN940415), is also available for use as a blocking control in assays to test for specificity of this MICA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MICA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MICA

Target: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Andere Bezeichnung: MICA

Hintergrund: MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Transition Metal Ion Homeostasis, Human Leukocyte Antigen (HLA) in Adaptive Immune Response