PNN Antikörper (N-Term)

Produktnummer ABIN634627

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PNN in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für PNN Antikörper (N-Term) (ABIN634627)

Target: PNN (Pinin, Desmosome Associated Protein (PNN))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNN Antikörper

Bindungsspezifität: N-Term

Spezifität: PNN antibody was raised against the N terminal of PNN

Aufreinigung: Affinity purified

Immunogen: PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNN Blocking Peptide, (ABIN5615437), is also available for use as a blocking control in assays to test for specificity of this PNN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNN

Target: PNN (Pinin, Desmosome Associated Protein (PNN))

Andere Bezeichnung: PNN

Hintergrund: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene, the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.

Molekulargewicht: 81 kDa (MW of target protein)