Transglutaminase 2 Antikörper
-
- Target Alle Transglutaminase 2 (TGM2) Antikörper anzeigen
- Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Transglutaminase 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY
- Top Product
- Discover our top product TGM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Transglutaminase 2 Blocking Peptide, catalog no. 33R-5634, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))
- Andere Bezeichnung
- Transglutaminase 2 (TGM2 Produkte)
- Hintergrund
- Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. TGM2 acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis.
- Molekulargewicht
- 77 kDa (MW of target protein)
- Pathways
- Tube Formation, Thromboxane A2 Receptor Signaling
-